• Slide1
  • Slide2
  • Slide3

Breaking News

  • Jembatan Gantung Bangun Seranten Diresmikan – read more
  • Wabup Tebo Syahlan Buka Sosialisasi Peraturan Pengadaan Barang Dan Jasa – read more
  • Pemkab Tebo beserta Pengadilan Tinggi Agama Tebo Fasilitasi Sidang Itsbat se-Kabupaten Tebo – read more
  • Bupati Sukandar : Budidaya Buah Hutan Untuk Anak Cucu Kita – read more
  • Menu Laman Tebo PINTAR Diluncurkan – read more
  • Rilis Hasil SP 2020 – read more
  • Penyuluhan Pelaksanaan Protokol Kesehatan Covid-19 pada Pengurus/ Anggota PGRI Kabupaten Tebo – read more
  • Wabup Syahlan Ikuti Rakor Penanganan Karhutla Provinsi Jambi – read more
  • Bupati Sukandar Resmikan Gedung Arsip BPN Tebo – read more
  • Penyerahan Bantuan oleh Timgus Covid-19 kepada Puskesmas Sungai Bengkal – read more
  • Wabup Tebo Ikuti Rakor Virtual Anev Kampanye Pilkada – read more
  • Bupati Tebo Hadiri Apel Siaga Karhutla Provinsi Jambi – read more
  • Bupati Sukandar Lapor SPT Tahunan – read more
  • Wakil Bupati Tebo Menghadiri Halalbihalal Polres Tebo – read more
  • Pengambilan Sumpah Jabatan Administrator dan Pengawas – read more
  • Pemkab Tebo Gelar MUSRENBANG Tahun 2019 – read more
  • Wabup Ikuti Vidcon Rakor Pencegahan Stunting – read more
  • Wabup Tebo Syahlan Buka Pelatihan Wasit Olahraga Futsal – read more
  • DPRD Setujui Ranperda Perubahan APBD T. A. 2020 – read more
  • Bupati Sukandar Dampingi Kapolda Resmikan Gedung Polsek Tebo Tengah – read more
  • Pengukuhan Pengurus Cabang Persatuan Tarbiyah Islamiyah (Tarbiyah- Perti) Kabupaten Tebo – read more
  • TP-PKK Kabupaten Tebo mengadakan Lomba Cipta Menu B2SA Tahun 2019 – read more
  • Peringatan HUT KORPRI ke-45 di Kabupaten Tebo – read more
  • Bupati Sukandar Resmikan Tugu Duren Unit 10 Rimbo Ulu – read more
  • Bupati Tebo Pimpin Rakor Penanganan PETI – read more
  • KPU RI Hadiri Sosialisasi Pemilihan Bupati dan Wakil Bupati Tebo 2017 – read more
  • Bupati Tebo memimpin Pelaksanaan Apel Siaga Banjir – read more
  • Rapat TKPRD Revisi RTRW Tebo – read more
  • Bupati Tebo Membuka In House Training Tingkat Dasar Pencegahan dan Pengendalian Infeksi – read more
  • Upacara Peringatan Hari Pahlawan Nsional – read more
  • Pemkab Tebo gelar Musrenbang 2018 – read more
  • Bupati Sukandar Buka Bimtek Kader Pengamanan Pangan Desa – read more
  • HUT Ke- 21, Bupati Sukandar Sampaikan Capaian Pembangunan Kabupaten Tebo – read more
  • Bupati Tebo Ajak Masyarakat Hidupkan Olahraga Tradisional dan Kebudayaan Tebo – read more
  • Bupati dan Wabup Tinjau Lokasi Pembangunan Polsek Tebo Tengah. – read more
  • Pertandingan Sepak Bola Forkompinda Tebo VS OPD Dengan Skor 6 - 2 – read more
  • Bupati bersama Kapolres Tebo meninjau Wilayah Banjir – read more
  • Pemkab Tebo Terima Penghargaan Pengelolaan Dana Desa Terbaik – read more
  • Pertemuan Rutin TP PKK Tebo – read more
  • Program Jaminan Sosial Ketenagakerjaan, Bupati Sukandar : Besar Manfaatnya Bagi Pekerja Formal/ Non- Formal – read more
  • Rakor Persiapan Pilkada dengan Forkopimda – read more
  • Pemkab Berkomitmen Selesaikan Masalah Kesehatan di Kabupaten Tebo – read more
  • Bupati Tebo menghadiri Rakor Dewan Ketahanan Pangan Provinsi Jambi – read more
  • Rakernas Pembangunan Pertanian 2021 – read more
  • Bupati Tebo Pimpin Apel Pergeseran Pasukan Pilkades Serentak – read more
  • Bupati Sukandar Pimpin Apel Siaga Karhutla – read more
  • Bupati Tebo Serahkan 190 SK CPNS Formasi Tahun 2019 – read more
  • Mau Sukses Jadi Kepala Sekolah?, Ini Resepnya – read more
  • Penghargaan Kabupaten/ Kota Terbaik I Nasional Progres Pengiriman Dapodik PAUD, Dikdas, dan Dikmen – read more
  • Wabup Syahlan Ikuti Vidcon Pelantikan Bupati/ Wabup Terpilih – read more
  • Rapat Paripurna DPRD Kab. Tebo, Memperingati HUT Kabupaten Tebo ke-20 Tahun 2019 – read more
  • Rapat Terbatas Timgus Covid-19 Tebo – read more
  • Wabup Syahlan : Pemulihan Ekonomi Nasional Bagi UMKM Di Kabupaten Tebo – read more
  • Bupati Sukandar Buka Sosialisasi P4GN Sekaligus Sambut Kunker Kepala BNN Jambi – read more
  • API 2019 Kemenpar RI, Kabupaten Tebo Juara III Makanan Tradisional Terpopuler – read more
  • Bupati Sukandar Hadiri Sosialisasi dan Penandatanganan Komitmen MPP – read more
  • Bupati dan Wabup Jalani Vaksinasi Covid-19 Pertama di Tebo – read more
  • Bupati Sukandar dan Wabup Syahlan Tinjau Lomba Kontruksi Tingkat Provinsi – read more
  • New Normal Road Race Sukses Digelar – read more
  • Sekda Tebo Menghadiri Rapat Persiapan LSS Tingkat Nasional – read more
  • Rapat Koordinasi Pengamanan Libur/ Cuti bersama – read more
  • Bupati dan Wabup Tebo Hadiri Syukuran Kades Terpilih Melako Intan – read more
  • Bupati Sukandar Dampingi Kapolda Jambi Tinjau Gedung Polsek Baru – read more
  • Lima Kali Berturut-turut, Pemkab Tebo Kembali Raih Opini WTP – read more
  • Sosialisasi Pelanggaran Disiplin PNS Kabupaten Tebo – read more
  • Bupati Inginkan Program Kerja Sasar Target – read more
  • Kadis Tebo: Guru Pembelajar Dorong Siswa Berprestasi – read more
  • Pemkab Tebo bersama TP PKK Serahkan Bantuan bagi Penyandang Disabilitas – read more
  • Wabup Syahlan Buka Sosialisasi Pilkades Serentak – read more
  • Bupati Tebo Membuka Acara Bupati Cup Tebo – read more
  • Wujudkan Pembelajaran Berkualitas, Masyarakat boleh Menyumbang melalui Jalur Komite Sekolah – read more
  • Pemkab Tebo Terima Bantuan Dari BRI – read more
  • Bupati Tanda Tangani Nota Kesepahaman PPI – read more
  • Sebanyak 2.840 Vial Vaksin CoronaVac Tiba Di Tebo – read more
  • Penyelenggaraan Sosisalisasi POM oleh Anggota DPR RI Drs. H.Zulfikar Ahmad – read more
  • Pelepasan ASN Memasuki Purna Tugas, Ir. Prayitno, M.Sc. – read more
  • TP PKK Tebo Lakukan Baksos dan Khitanan Massal serta Workshop PAUD – read more
  • Bupati Tebo Dan Wabup Sholat Ied Di Mesjid Agung Al-Ittihad – read more
  • Rakor Persiapan Pilkada, Sekda Tebo Tandatangani Pakta Integritas Patuh Protokol Kesehatan – read more
  • Keberhasilan Kabupaten Tebo dalam mendapatkan WTP dari BPK RI – read more
  • Ketua TP PKK Tebo Terima Vaksin Covid-19 – read more
  • Wabup Syahlan Ikuti Vidcon Sinergitas Pelaksanaan Omnibus Law – read more
  • Kajati Jambi Meresmikan Pusat Informasi SAD Desa Muara Kilis – read more
  • Doa dan Dzikir Bersama Awal Tahun 2021 – read more
  • Bupati dan Wabup Tebo Kompak Isi SP online – read more
  • Penambahan Armada Pemadam Kebakaran – read more
  • HAN, Bupati Sukandar Dampingi Kunker Anggota DPR RI Hj. Saniatul Lativa – read more
  • Pemkab Tebo Terus Tekan Angka Kemiskinan – read more
  • Bupati dan Wabup Sambut Kunker Pangdam ll Sriwijaya – read more
  • Bupati Tebo Ajak Mahasiswa Sikapi Pandemi sebagai Momentum Menguasai Teknologi – read more
  • Jajaran Diskominfo Tebo Ikut Rakornas ForK4SI Via Vidcon – read more
  • Kabupaten Tebo Raih Penghargaan Penyaji Tari Terbaik ll – read more
  • Pemkab Tebo Raih Predikat B Implementasi SAKIP – read more
  • Bupati Sukandar Tinjau Posko Siaga Covid- 19 – read more
  • Bimtek Refocusing APBN dan Pengawasannya – read more
  • Wakil Bupati Tebo Menyerahkan 165 SK CPNS Formasi Tahun 2018 – read more
  • Wabup Syahlan Hadiri Rakor Kependudukan dan Pencatatan Sipil – read more
  • Bupati Sukandar Lepas Putra Terbaik Tebo ke Ajang Lomba Nasional – read more
  • Telekonferensi Bupati Sukandar bersama Gubernur Jambi – read more
  • Sosialisasi Penghargaan Jaminan Sosial Ketenagakerjaan ( Anugerah Paritrana ) – read more
  • Bupati Sukandar Dampingi Tim Korlantas Polri Tinjau Lokasi Pembangunan SDC – read more
  • Pembukaan Pameran Pembangunan Tebo Expo ke-20 Tahun 2019 – read more
  • Siswa Siswi Sekolah Tebo Lolos Seleksi Paskibraka Tingkat Provinsi dan Nasional – read more
  • Sekda Tebo Buka Sosialisasi dan Konsolidasi Tim Pokja PUG – read more
  • Kunjungan Kepala KPP Pratama Muara Bungo – read more
  • Bupati Tebo menghadiri Sosialisasi Penyuluhan Narkoba – read more
  • Penandatanganan Addendum Perjanjian Kerja Sama Bidang Pertanahan – read more
  • Bupati Tebo Serahkan Piagam Penghargaan Kepada Camat Teladan – read more
  • Bupati Tebo Kembali Rombak Pejabat Eselon III dan IV – read more
  • Audiensi Bupati Sukandar bersama BKSDA Jambi – read more
  • Kunker Kepala BNN Provinsi Jambi di Kabupaten Tebo – read more
  • Sekda Tebo Hadiri Rakor Eksternal Operasi Mantap Praja – read more
  • Sekda Motivasi Kader HMI saat Intermediate Training – read more
  • Rakor Virtual Penguatan TPKP – read more
  • Sekda Tebo Membuka Acara Sosialisasi LKTI Tingkat SLTA dan Perguruan Tinggi – read more
  • Pendataan Keluarga 2021 Dimulai, Bupati, Wabup dan Sekda SUDAH TERDATA – read more
  • Pisah Sambut Ketua PA Tebo – read more
  • Penyerahan JPS Tahap lll Pemprov Jambi – read more
  • KPU Tebo Gelar Jalan Sehat Menuju Pilkada Serentak 2017 – read more
  • Pemkab Tebo Gelar Forum Perangkat Daerah Kabupaten Tebo Tahun Anggaran 2020 – read more
  • Sekda Lantik Pejabat Struktural Lingkup Pemkab Tebo – read more
  • Deklarasi Forum KEE : Bupati Sukandar Harapkan Ekosistem dan Habitat Gajah Terjaga – read more
  • Upgrade Diri Untuk Berkontribusi – read more
  • Sertijab Kalapas Kelas II B Muara Tebo – read more
  • Bupati Sukandar Harapkan Kerja Sama Hasilkan Pascasarjana Berkualitas – read more
  • Bupati Sukandar Lantik PNS Pejabat Administrator dan Pengawas – read more
  • Sinergitas Ormas dan Pemda Tingkatkan Partisipasi Pembangunan – read more
  • Wabup Tebo Ikuti Rakor Evaluasi Pilkada Tahun 2020 – read more
  • Bupati Sukandar Pimpin Rapat Gugus Tugas Penanggulangan Covid-19 – read more
  • Pemkab Tebo Laksanakan Senam Rutin Bersama – read more
  • Wabup Syahlan Pimpin Forum Kemitraan dengan Pemangku Kepentingan – read more
  • Bupati Sukandar Dukung Program Ketahanan Pangan – read more
  • Peletakan Batu Pertama Pembangunan Rumah Besar PMII Tebo oleh Bupati Sukandar – read more
  • Apel Gelar Pasukan Operasi Ketupat 2019 di Mako Polres Tebo – read more
  • Pesantren Kilat Ramadhan 1440 H Kabupaten Tebo Ditutup – read more
  • Diskominfo Tebo Gelar Bimtek PPID Dan Lapor – read more
  • Bupati Sukandar Pimpin Musrenbang Perubahan RPJMD – read more
  • Finalisasi Batas Daerah, Bupati Sukandar Inginkan Pemahaman dan Komitmen Bersama – read more
  • Wabup Tebo Syahlan Hadiri HUT Ke - 102 Damkar Dan Penyelamatan Secara Virtual – read more
  • Wabup Tebo Tutup Lomba Kontruksi Provinsi, Merangin Juara Umum – read more
  • Kabupaten Tebo Jadi Pilot Project Penerapan Pertumbuhan Ekonomi Hijau – read more
  • Rapid Test di Lingkungan Pemkab Tebo – read more
  • Bupati Sukandar Pimpin Upacara Peringatan HUT Kemerdekaan RI Ke-75 – read more
  • Wakil Bupati Tebo Menghadiri Forum Group Discussion (FGD) – read more
  • Bupati Tebo Panen Raya Padi Sawah di Desa Kuamang – read more
  • Bupati Sukandar Dampingi Gubernur Fachrori Serahkan JPS Tahap ll – read more
  • HSN 2020, Bupati Tebo Tandatangani Hibah Daerah – read more
  • 30 Pilkades Tebo Digelar Serentak, Pemkab Tebo Bentuk Tim Monitoring – read more
  • Peringatan Hari Guru Nasional (HGN) dan HUT Ke-71 PGRI Tahun 2016 Kab. Tebo Dipusatkan di Rimbo Ilir – read more
  • Bupati Sukandar Sampaikan Gambaran Umum Perubahan APBD 2020 – read more
  • Bupati Tebo Hadiri Peringatan Hari Santri Nasional – read more
  • Pelaksanaan Operasi Zebra 2016 di Kabupaten Tebo – read more
  • Pemkab Tebo Mengadakan Sosialisasi Program RTLH Tahun 2009 – read more
  • Himbauan Bupati Tebo Waspada Virus COVID - 19 ( Corona ) – read more
  • Rakor Penyesuaian Anggaran dan Belanja Daerah Tahun 2020 – read more
  • Upacara Peringatan Hari Kesaktian Pancasila – read more
  • 15 Pasien Meninggal Di Tebo Dimakamkan Dengan Protokol Covid, 6 Pasien Positif – read more
  • Pemkab Tebo Menghadiri Open House Gubernur Jambi – read more
  • Audiensi Pj. Gubernur Jambi Hari Nur Cahya Murni Dengan Jajaran Pemkab Tebo – read more
  • Sekretaris Daerah Kab. Tebo Membuka Acara Bhakti Sosial TNI Manunggal KB-KES di Desa Giriwinangun – read more
  • Ragam Cara Bikin Siswa di Tebo Bahagia Selama Pandemi, Dari Poster Cegah Corona Hingga Buat Cerita Bergambar – read more
  • Rehabilitasi Hutan, Bupati Sukandar Tanam Pohon Bersama Danrem 042/ Gapu – read more
  • Ketua DWP Tebo Kukuhkan Pengurus DWP Setda – read more
  • Perubahan RPJMD Sesuaikan Dengan Prioritas Pembangunan – read more
  • KLA, Wabup Syahlan Targetkan Tebo Untuk Predikat Madya – read more
  • Sekda Hadiri Rakor RANHAM dan Pelaporan Kabupaten/Kota Peduli HAM – read more
  • Bupati dan Wabup Sambut Kunjungan Kajati Tebo – read more
  • Bupati Tebo Tutup Final Turnamen Volly Tegal Arum Cup 2019 – read more
  • Produksi Pertanian Naik, Petani Diminta Tetap Berinovasi – read more
  • Bupati Tebo Menghadiri Pembukaan Gebyar Pelajar Pelopor Keselamatan Berlalu Lintas – read more
  • Silaturahmi Gubernur Fachrori di Ujung Masa Tugas – read more
  • Pemkab Terima Bantuan 100 Pakaian APD – read more
  • Wakil Bupati Tebo Menyampaikan Nota Pengantar LKPJ Bupati Tebo Tahun Anggaran 2018 – read more
  • Puluhan Guru SMP Tebo Antusias Ikuti Pelatihan Program PINTAR – read more
  • Bupati Tebo Menghadiri Apel Gelar Pasukan Menghadapi Pemilu 2019 – read more
  • Pelaksanaan SKB CPNS Tebo Dimulai, Sekda Teguh Ucapkan Selamat Berjuang – read more
  • Wabup dan Sekda Sambut Wawako Jambi – read more
  • Bupati Sukandar Buka Sosialisasi Pendataan Keluarga – read more
  • Selama Puasa Ramadhan Pasar Beduk Di Tebo Ditiadakan. – read more
  • Penyaluran Bantuan Korban Bajir – read more
  • Saniatul Lativa Harap Generasi Muda Tebo Sibukkan Diri dengan Kegiatan Positif – read more
  • Sekretaris Daerah Kab. Tebo Membuka Raker Kepegawaian – read more
  • Wabup Syahlan Tutup Intermediate Training HMI – read more
  • Penurunan Bendera Virtual – read more
  • Hj. Saniatul Lativa Buka Pelatihan Tata Boga – read more
  • Kpu Tebo bersam Dukcapil melakukan Pemukhtahiran Data Pemilih – read more
  • Guru di Kabupaten Tebo Dilatih Pembelajaran Abad 21 – read more
  • Bupati Tebo Mengukuhkan Forum Kabupaten Tebo Sehat Tahun 2019 – read more
  • Wakil Bupati Tebo Menghadiri Lomba Fashion Show Tengkuluk Batik Tebo – read more
  • Puncak PGRI Ke-75 Diperingati Secara Virtual, Bupati Sukandar Peroleh Dwija Praja Nugraha – read more
  • Rapat Pembahasan Draft Naskah Kerjasama Kemitraan Kehutanan – read more
  • Asyiknya Belajar Bahasa Inggris dengan Membuat Greeting Card – read more
  • Wakil Bupati Tebo Membuka Rakor Penanggulangan Kemiskinan – read more
  • Bupati Sukandar Hadiri Apel Gelar Pasukan – read more
  • Bupati Tebo Buka Workshop Monev DD – read more
  • Kunker Pjs. Gubernur Jambi dan Rakor Persiapan Pilkada Serentak – read more
  • Bupati Buka Intermediate Training HMI – read more
  • Dinas PUPR Kabupaten Tebo Terima Kunjungan Studi Banding Komisi III DPRD Batanghari – read more
  • Bupati Tebo Menggelar Coffee Night Bersama Akademisi dan Tokoh Masyarakat – read more
  • Pemkab Tebo Mendukung Program Peningkatan Konsumsi Karet Rakyat untuk Infrastruktur Jalan – read more
  • Wakil Bupati Tebo menghadiri Apel Gelar Pasukan 2019 – read more
  • Bupati Tebo Membuka Secara Resmi Bupati Cup 2019 – read more
  • Wakil Bupati Tebo Hadiri Pembukaan Festival Batanghari 2019 – read more
  • Prestasi dan Evaluasi Dasar Untuk Penyelenggaraan Pemerintah Lebih Baik – read more
  • Pemkab Tebo MoU dengan Tanoto Foundation – read more
  • Kapolda Jambi Akan Tinjau Posko Copid-19 Tebo – read more
  • Bupati Sukandar Tandatangani berita acara serah terima Hibah Barang Milik Negara – read more
  • Wabup Syahlan Harap NW Beri Warna pada Pembangunan – read more
  • Forum Konsultasi/Pertemuan Teknis Pelaksanaan Kegiatan Pembinaan Jasa Konstruksi TA. 2021 di Provinsi Jambi – read more
  • Bupati Tebo Membuka Rapat Pembinaan dan Pengembangan Kota Layak Anak Provinsi Jambi Tahun 2019 – read more
  • Diskominfo Tebo : 70 ODP, Warga Jangan Panik – read more
  • Bupati dan Wabup Ikuti Pidato Kenegaraan secara Virtual – read more
  • Bupati Tebo Lantik 30 Kades Terpilih – read more
  • Upacara Pengukuhan Batalyon C Sat Brimob – read more
  • Sosialisasi Program Beras ASN – read more
  • Seluruh Fraksi DPRD Tebo Setujui Ranperda Pelaksanaan APBD T.A. 2019 – read more
  • Lomba UPPKS Tingkat Provinsi di wakili oleh Desa Tegal Arum – read more
  • Bupati Tebo Membuka MTQ Tingkat Kabupaten Tebo ke-XVIII – read more
  • Wabup Syahlan Hadiri Penandatanganan MoU Kehidupan Beragama – read more
  • Bupati Tebo Membuka Jambore Kader PKK Tingkat Kabupaten – read more
  • Pelantikan Ketua PKK Dan Pengukuhan Satuan Linmas Muara Tabir – read more
  • Bupati Tebo Hadiri Pelantikan Pimpinan DPRD Kabupaten Tebo – read more
  • Imbauan Larangan PETI – read more
  • Sidang Paripurna DPRD Kabupaten Tebo Dalam Rangka Pendapat Akhir Fraksi terhadap LKPJ Bupati Tebo TA 2018 – read more
  • Upacara Penurunan Bendera Sang Merah Putih – read more
  • Rakernas Pembangunan Pertanian – read more
  • Tanoto Foundation Gelar Webinar Manajemen Pembelajaran Daring untuk Sekolah Pedesaan – read more
  • Sekda Tebo Teguh Arhadi Dan Kepala OPD Di Vaksin Covid19 – read more
  • Ketua TP PKK Buka Pelatihan UP2K – read more
  • DPRD Tebo gelar rapat paripurna Anggaran Tahun 2017 – read more
  • Jadikan Jujur dan Disiplin Fondasi Utama Untuk Berkembang – read more
  • Bupati Tebo Hadiri LKD PC Muslimat NU Angkatan ke-2 – read more
  • Wabup Syahlan Ikuti Konferensi Video Penanganan Covid- 19 – read more
  • Peraturan Bupati Tebo tentang Penerapan Disiplin dan Penegakan Hukum Protokol Kesehatan untuk menekan penyebaran Covid-19 di Kabupaten Tebo – read more
  • Syarat untuk Melakukan Pemilihan dalam Pemilu 2017 – read more
  • Bupati Sukandar Pimpin Pengambilan Sumpah/ Janji 169 PNS, Tenaga Honorer dan PTT Kemenkes RI – read more
  • Wakajati Jambi didampingi Bupati Tebo Berikan Bansos SAD di Muara Kilis – read more
  • Bupati Sukandar Hadiri Penyerahan Bantuan OJK Jambi kepada IAI – read more
  • Tim Bola Volly PGRI Kab. Tebo Meraih Juara 1 – read more
  • Bupati Tebo Sambut Baik BPOM Jambi Akan Laksanakan Bimtek Kader – read more
  • Bupati Tebo : Tingkatkan Kewaspadaan Penularan Covid-19, pelajar diliburkan 14 hari. – read more
  • Desa Giriwinangun Ditunjuk Sebagai Desa Sadar Jaminan Sosial Ketenagakerjaan – read more
  • Simulasi Pemungutan ditutup dengan Penghitungan Surat Suara – read more
  • Sekretaris Daerah hadiri Pembukaan Lomba Peragaan Busana dan Desain Motif Batik – read more
  • Acara Pisah Sambut Kapolres Tebo Tahun 2016 – read more
  • Penyerahan Bantuan Kepada Lansia – read more
  • Sekda Tebo Menghadiri Pelantikan Pengurus THC Tebo – read more
  • Bupati Tebo Buka Kapolres Cup 2019 – read more
  • Sekda Tebo Buka Acara Sosialisasi Pengelolaan Keuangan Daerah – read more
  • Pelantikan DPD KNPI, Wabup Tebo : Hilangkan Ego Sektoral Menuju Tebo Tuntas – read more
  • Peletakan Batu Pertama Pembangunan BLKK PGID Teb – read more
  • Bupati Sukandar Dukung Pelaksanaan SP 2020, Dimulai 1 September – read more
  • Asuransi Bagi Petani Sawah – read more
  • 193 Warga Binaan Lapas IIB Tebo Mendapatkan Remisi – read more
  • Pemkab Tebo Launching e-SAKIP dan Sosialisasi Perbup Nomor 73 Tahun 2019 – read more
  • Peringatan Hari Pahlawan Kabupaten Tebo – read more
  • Kolaborasi Kunci Sukses Pelaksanaan SP 2020 – read more
  • Bupati Tebo Sampaikan Tiga Pembahasan Utama pada Rakor dengan Pjs. Gubernur Jambi – read more
  • Pengukuhan Pengurus PPDI, Bupati Tebo Harapkan Sinergitas Pembangunan Desa Lebih Baik – read more
  • Wabup Syahlan Terima Bantuan Penanganan Covid-19 dari Persatuan Notaris – read more
  • Pemkab Tebo Gelar Acara Pisah Sambut Ketua Saber Pungli dan Kapolres Baru – read more
  • Bupati Sukandar Pimpin Pelaksanaan Disinfeksi – read more
  • Bupati Tebo Monev Proyek Tahun Anggaran 2019 – read more
  • Empat Tim Bentukan Pemkab. Tebo Pantau Pilgub / Wagub Jambi – read more
  • Penyerahan Sertipikat Tanah – read more
  • Pasca Zona Hijau Covid-19, Pemkab Tebo Gelar Senam Bersama – read more
  • Bupati Sukandar Apresiasi Kartu Sehat IDI Tebo – read more
  • Wakil Bupati Tebo Menghadiri Khotmil Qur'an ke-23 Ponpes Raudhatul Mujawwidin – read more
  • Bupati Tebo Menyerahkan Bantuan BPJS Ketenagakerjaan dan Kenaikan Pangkat – read more
  • Pembagian dan Kampanye Masker Serentak – read more
  • Wabup Syahlan Apresiasi Qori Qoriah Tebo Peraih Juara Pada MTQ Ke-49 Tingkat Provinsi Jambi – read more
  • Bupati Tebo menghadiri pelantikan kepengurusan KONI Tebo – read more
  • Pemkab Terus Dukung Polres Berikan Pelayanan Terbaik – read more
  • Grand Opening Sanggar Seni – read more
  • Sosialisasi Pembayaran Gaji PNS melalui Bank Jambi – read more
  • Pemkab Tebo Kembali Raih Penghargaan Kabupaten/ Kota Peduli HAM – read more
  • Wabup Syahlan Dukung Peningkatan Kualitas Pelayanan Kesehatan – read more
  • Bupati Tebo Safari Ramadhan di Desa Muara Niro Kecamatan VII Koto – read more
  • Sekda Buka Sosialisasi Perpajakan – read more
  • Penyerahan SK PNS 2016 Kabupaten Tebo – read more
  • Bupati Sukandar Hadiri Rakor Sertifikasi Aset Pemda dan PLN Di Provinsi Jambi. – read more
  • Bupati Sukandar TInjau Terminal – read more
  • Bupati Sukandar Hadiri Khotmil Quran TPA Mafatihul Hikmah – read more
  • Wabup Tebo Syahlan Hadiri Penyambutan Satgas Pamtas RI - RDTL – read more
  • Penandatanganan Dukungan Deklarasi Sekolah Ramah Anak di SDN 149 Muara Tebo – read more
  • Bupati dan Wabup Sambut Polres Tebo Baru – read more
  • Bupati Tebo melantik 33 orang Pengurus FORDAS – read more
  • Satu PDP meninggal, Gugus Tugas Tebo Gerak Cepat Semprot Desinfektan ke RSU – read more
  • Pembagian Hadiah Kepada Juara Bupati CUp 2016 oleh Bupati Tebo – read more
  • Wabup Syahlan Salurkan Bantuan untuk Korban Banjir – read more
  • Rapat Evaluasi Pelaksanaan SKB – read more
  • Bupati Sukandar Rapat Bersama Tim Gugus Tugas Covid- 19 – read more
  • Bupati Tebo Terima Kunjungan Kerja Danrem 042/GAPU – read more
  • Bupati Sukandar Buka Seminar dan Pelantikan Pergunu Tebo – read more
  • Pemkab Tebo Terima Plakat Penghargaan dari Kemenkeu – read more
  • Hari Ke-2 Puasa Ramadhan 1440 H, Wakil Bupati Tebo Kultum di Masjid KH. Zaharuddin Usman – read more
  • Wisuda IAI, Sekda Pinta Wisudawan/Wisudawati Terus Kembangkan Kompetensi – read more
  • Bupati Tebo Buka Bersama Anak Yatim, Lansia Dhuafa di Rimbo Bujang – read more
  • Silaturahmi Kapolres Tebo Baru – read more
  • Pembukaan Sosialisasi Empat Pilar MPR-RI – read more
  • Sekumpulan Gajah Kembali Menyerang Perkebunan Warga – read more
  • Bupati Tebo H. Sukandar Terima PWI Jambi Awards Tahun 2021 – read more
  • Bupati Cup Berakhir, Bupati Sukandar Serahkan Piala dan Uang Pembinaan Kepada Juara – read more
  • Upacara Besar Deklarasi Kebhinekaan Cinta Damai – read more
  • Bupati Tebo Melantik Kepala Sekolah, Fungsional Pendidikan dan Penyuluh Pertanian – read more
  • Bupati Sukandar Sampaikan Ranperda Pertanggungjawaban Pelaksanaan APBD – read more
  • Bupati Tebo Membuka Sosialisasi Parenting Keluarga – read more
  • Bupati dan Wabup Ikuti Rakor Virtual Pertashop – read more
  • Bupati Tebo Menghadiri Peletakan Batu Pertama Masjid Nurul Iman Desa Sungai Bengkal Barat – read more
  • Bantuan Baksos dan Program Kejar Bank Jambi Bersama SAD – read more
  • Rakor Satgas Covid 19 Jambi dalam Menyambut Libur Natal dan Tahun Baru 2021 – read more
  • Upacara virtual HUT TNI Ke-75 – read more
  • Bonus Besar Menanti Kafilah Berprestasi di MTQ Tingkat Provinsi – read more
  • Pemkab Tebo Empat Kali Berturut-turut Raih WTP – read more
  • Bupati Tebo Menghadiri HUT SATPOLPP dan SATLINMAS Tingkat Prov. Jambi – read more
  • Kunker Perwakilan Kemenhan – read more
  • Siswa Belajar dari Rumah, Guru di Tebo Tetap Lakukan Pembelajaran Aktif – read more
  • Gowes Nusantara Menyemarakkan HUT Kabupaten Tebo Ke-20 – read more
  • Bantuan APD – read more
  • Bupati Sukandar Hadiri Panen Bersama di Tebo Ilir – read more
  • 2 PDP Tebo Terkonfirmasi Positif Dinyatakan Sembuh, Bupati Sukandar Serahkan Kepada Keluarga – read more
  • Ketua TP PKK Buka Pelatihan UP2K di Dua Kecamatan Sekaligus – read more
  • Bupati Sukandar Sambut Baik KTH Binaan Perusahaan – read more
  • Ketua TPP- PKK Tebo Saniatul Lativa Lantik Ketua PKK Kecamatan/Desa Dan Adakan Pelatihan Kader – read more
  • Bupati dan Wabup Tebo Hadiri Paripurna Pendapat Akhir Fraksi DPRD Tentang 8 Ranperda – read more
  • Bupati dan Wabup Ikuti Upacara HUT Bhayangkara via online – read more
  • Diskominfo Sosialisasikan Perbup Tebo Tentang Penegakan Protokol Kesehatan – read more
  • Bupati dan Wabup Pimpin Rapat Forum Kemitraan BPJS Kesehatan – read more
  • Wabup Tebo Ikuti Vidcon Hari Kesaktian Pancasila – read more
  • Pengoptimalan DD/ ADD Sukseskan Pemerataan Pembangunan – read more
  • Wabup Syahlan Ikuti Rapat Kerja Nasional Akuntansi dan Pelaporan Keuangan Pemerintah Tahun 2020 via virtual – read more
  • Pemkab Tebo dan Unja Tandatangan MoU Bidang Pendidikan, Penelitian dan Pengabdian. – read more
  • Penandatanganan Nota Kesepakatan dan Dokumen Rencana Kerja – read more
  • Bupati Sukandar Buka Lomba Administrasi 10 Program Pokok TP PKK – read more
  • Penyerahan LHP T.A 2020 oleh BPK Jambi – read more
  • MUI Provinsi Jambi Safari Ramadhan di Kabupaten Tebo – read more
  • Bupati Sukandar Hadiri Peringatan Isra Mikraj – read more
  • Turun Mandi Aek Tebo Ditetapkan sebagai WBTI dari Kemendikbud RI – read more
  • Hj. Saniatul Lativa Secara Maraton Buka Pelatihan 10 Program Pokok PKK – read more
  • Milad KAHMI dan KOHATI Ke- 54, Bupati Sukandar : Berikan Kontribusi Dalam Mengisi Pembangunan – read more
  • Buah Naga Merah Komoditi Rintisan Prospektif Dikembangkan di Kabupaten Tebo – read more
  • TP-PKK Kabupaten Tebo Berprestasi pada HKG-PKK ke-47 Provinsi Jambi – read more
  • Bantuan Nakes Puskesmas Rimbo Bujang II – read more
  • Perjanjian Kerjasama Pemkab Tebo dengan Kantor Pertanahan – read more
  • Puncak HKN, Bupati Tebo Olahraga Bersama Insan Kesehatan – read more
  • Bupati Tebo Mengisi Kultum di Masjid KH. Zaharuddin Usman – read more
  • Bupati dan Wabup Tebo Buka Turnamen Piala Askab PSSI Tebo – read more
  • Bupati H. Sukandar Pimpin Upacara HUT Bank Jambi ke - 58 Di Muara Tebo – read more
  • Wabup Ikuti Vidcon Sosialisasi PP. No. 42 Tahun 2020 – read more
  • Hj. Saniatul Lativa Buka Pelatihan 10 Program Pokok PKK – read more
  • Himbauan Bupati Tebo Tentang Peningkatan Kewaspadaan Terhadap Resiko Penularan Infeksi Covid-19 – read more
  • Peringatan Hari Kesehatan Nasional 2020 – read more
  • Pelatihan Kewirausahaan, Wabup Syahlan Harapkan Pemuda Ciptakan Kesempatan Kerja – read more
  • Kabupaten Tebo Raih Penghargaan pada Puncak BBGRM, HAN dan TTG Tingkat Provinsi Jambi – read more
  • Bupati Sukandar Pinta Peran Aktif Semua Elemen Tangkal Ancaman IPOLEKSOSBUDHANKAM – read more
  • Pisah Sambut Dandim 0416/ BUTE – read more
  • Bupati Tebo Sukandar Terima Bantuan Alkes Melalui Anggota DPR Komisi IX – read more
  • Apel Konsolidasi Operasi Kepolisian Terpusat 2019 di Mako Polres Tebo – read more
  • Pemkab Tebo Bekerjasama dengan Polres Tebo dan Kodim 0146/Bute Gelar Sholat Istisqo – read more
  • Sosialisasi Protokol Kesehatan dalam Pencegahan Covid-19 – read more
  • Pemerintah Kabupaten Tebo Siap Dukung Sosialisasi Operasi Bina Waspada Siginjai 2020 – read more
  • Konsolidasi Kesiapan Penanganan Bencana Hidrometeorologi – read more
  • Wabup Hadiri Pelantikan Pengurus DMI Tebo Periode 2020-2023 – read more
  • Penyerahan DIPA dan TKDD secara Virtual oleh Pjs. Gubernur Jambi – read more
  • Peninjauan Lokasi oleh Tim Gugus Tugas Kabupaten Layak Anak Kabupaten Tebo – read more
  • Wabup Syahlan Hadiri Workshop Pembangunan Perkebunan Berkelanjutan – read more

Asyiknya Belajar Bahasa Inggris dengan Membuat Greeting Card

Senin, 15 Maret 2021

Dinas Komunikasi dan Informatika

Oleh: Andwi Putri Rezki, S.Pd

Guru SMPN 2 Tebo/ Fasilitator Program PINTAR Tanoto Foundation

Mengajar Bahasa Inggrismemilikitantangantersendiri, karenabukanbahasa yang sehari-harikitaucapkan.Guru harusmemilikistrategi agar pembelajaranmenarik dan menyenangkan bagi siswa.

Guru harusmemberikanpemahamanbahwa Bahasa Inggrisitutidaksulitdanmenegangkan.

Kita bisamengajaksiswabelajarbahasaInggrisdenganmelakukankegiatan yang membuatkreativitassiswaterasah.

Belajarsambilberkreasiakanmemberikanpenyegaranpikiran, membentukdayaimajinasisertamengembangkankreativitassiswasehinggakemampuankognitifdanskillsiswatersebutakanberkembang.

Sebagai guru Bahasa Inggrissayaberusahamembuat proses pembelajarandi kelasmenyenangkan.Padabeberapawaktulalu,sayamengajarmateri greeting card.Sayamengajaksiswabelajarmenuliskalimatdalam Bahasa Inggrissambilberkreasi.

Saya mencoba membangkitkan minat siswa di kelas VIII A SMPN 2 KabupatenTebo dengan belajarasyik dan sukacitalewatkreasiedukasi.

Kreasipembelajarantersebutmelalui Greeting card. Greeting card ataukartuucapanadalahkartu yang berisikanpesansepertidoa,harapan, rasa terimakasihkepadaseseorang.

Tujuanpembelajarandarikartubergantungpadasituasipenerimakartutersebut. Untukkelassaya, greeting card yang dibuatditujukanuntukseorangIbu, yang mana berisirangkaian kata cintauntukIbu.

Denganalasanitulahsayamengajaksiswabelajarmembuatgreeting card yang ditujukankepadaIbu. SiswabelajarmenuliskalimatdalambahasaInggrisdanjugabisamempererathubunganorangtuadananak.

Padasaat proses pembelajaran, setiapsiswabekerjasecaraindividuuntukmendesaingreeting card. Mereka membuat kreasi dalam mendesain greeting cardsesuai ide merekamasing-masingsecara terampil, percaya diri, dan juga kreatifdenganmenanamkankonsepMIKiR.

Kemudianmengekspresikan apa yang ada dalam pikiran merekalewattulisan kata cintauntukseorangIbu.Kegiatan ini dilakukan dengan gembira dan tanpa beban karena siswa dapatmengembangkankreativitas.

Kreativitassetiapanakpentinguntukdikembangkanhalinisenadadenganapa yang disampaikanolehMartini (2006: 58), iamengemukakanbahwatujuankreativitasadalahanakdapatmendapatkankesempatanuntukmewujudkanberbagaiinisiatif yangdipikirkannya yang akanberkembangmenjadianak yang percayadiri.

Dalammembuatgreeting cardini, setiapsiswabekerjadenganberdasarkanpetunjukpadalembarkerja yang disediakan, kemudian siswa mendesain greeting card, dengan bahan-bahan seperti karton, kertas origami, lem, danbarang bekas yang bisa dijadikan hiasan untuk greeting card. Setelah itu, siswamenulis (writing).

Kreativitas siswa pun tergali, jari jemari merambat menari tak mau berhenti membuat kreasi, mereka antusias dan aktif dalam pembelajaran.

Melaluikegiatanini, sebenarnyasiswasedangmempraktikkanketerampilanmenulisdanketerampilanberkreasidalammendesain yang dimilikinyasecaralangsung.

Lewatpraktikinisiswamendapatkandanmenemukanpengalamanunik yang dapatmembangunpengetahuannyadanmengembangkandirinyasendiri.

Dalammembuatgreeting cardsetiapsiswaharusmemperhatikangeneric structuredarigreeting card. Terdiridarireceiver (penerima), body (isi) dansender (pengirim).

Contoh isi greeting card yang di buatoleh Clara MeybiLisyasiswikelas VIII A:



Dear Mom,

I love you mom,you’re the best listener,thank you for being such a great mom. You are my friend, my spirit. You make everything more beautiful.

Your daughter,

Clara MeybiLisya



Setelah greeting card jadi, lalu diberikan kepada Ibu. Sederet senyum tawa menghiasi wajah rupawan Ibu, ketika menerima greeting card berisi rangkaian kata cinta dari putra putri mereka.

Pesan singkat ini memang sangat sederhana namun sangat berarti karena dapat membuat sang ibu merasa dicintai dan dihargai.

Saya sebagai guru ikut terharu, tak terasa bulir-bulir bening menetes menghiasi kelopak mata ini, ketika menyaksikan karya siswa bisa disampaikan kepada orangtua.

Hasil dari pembelajaran ini kreativitas siswa terasah, siswa menjadi aktif, kemampuan menulis dalam bahasa Inggris bertambah, keakraban dan komunikasi orang tua dan anak menjadi semakin kuat dan berdampak positif.

Sehingga terciptalah sebuah kreasi edukasi melalui materi greeting card.

Pembelajaran yang sederhana, namunmembuatsiswamampumenulisucapandalam Bahasa Inggris, sepertirefleksi yang disampaikan Clara.

“Senang, bisabelajaraktifbersamaibuAndwi, kinisayabisamembuatucapandengan Bahasa Inggris” ujar Clara dalamrefleksi di akhirpembelajaran.